Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDX-1/IPF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP238865
Description
PDX-1/IPF1 Polyclonal specifically detects PDX-1/IPF1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PDX-1/IPF1 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| P52945 | |
| PDX1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA | |
| 0.1 mL | |
| Lipid and Metabolism, Stem Cell Markers | |
| 3651 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Glucose-sensitive factor, IDX-1GSF, Insulin promoter factor 1, insulin promoter factor 1, homeodomain transcription factor, Insulin upstream factor 1, IPF1pancreas/duodenum homeobox protein 1, Islet/duodenum homeobox-1, MODY4IUF1, pancreatic and duodenal homeobox 1, pancreatic-duodenal homeobox factor 1, PDX-1IPF-1, somatostatin transcription factor 1, Somatostatin-transactivating factor 1, STF-1IUF-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction