Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Peflin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | Peflin |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB125063
|
Novus Biologicals
NBP310081100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Peflin Polyclonal specifically detects Peflin in Human samples. It is validated for Western Blot.Specifications
Peflin | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
ABP32, PEF protein with a long N-terminal hydrophobic domain, PEF1A, peflin, penta-EF hand domain containing 1, Penta-EF hand domain-containing protein 1, penta-EF-hand domain containing 1 | |
The immunogen is a synthetic peptide directed towards the middle region of human Peflin (NP_036524.1). Peptide sequence QGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCL | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
553115 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title