Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEG10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
$382.00 - $646.00
Specifications
Antigen | PEG10 |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PEG10 Polyclonal specifically detects PEG10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PEG10 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
23089 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Rabbit | |
Human | |
embryonal carcinoma differentiation regulated, Embryonal carcinoma differentiation-regulated protein, HB-1, KIAA1051EDR, Mammalian retrotransposon-derived protein 2, Mar2, Mart2, MEF3 like 1, MEF3L, MEF3L1, Myelin expression factor 3-like protein 1, paternally expressed 10, Paternally expressed gene 10 protein, retrotransposon gag domain containing 3, Retrotransposon gag domain-containing protein 3, Retrotransposon-derived gag-like polyprotein, retrotransposon-derived protein PEG10, RGAG3MEF3-like protein 1, Ty3/Gypsy-like protein | |
PEG10 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title