PELI3 Rabbit anti-Human, Polyclonal , Abnova™

Catalog No.	Quantity
89-934-760	100 μL

Catalog No. 89-934-760 Supplier Abnova Corporation Supplier No. PAB29481

Description

PELI3 polyclonal antibody raised against recombinant human PELI3.

Toll-like receptors (TLRs; see MIM 603030) and IL1R (IL1R1; MIM 147810) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R (Jensen and Whitehead, 2003 [PubMed 12874243]).[supplied by OMIM]

Sequence: RSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQ

Specifications

• Antigen: PELI3
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: PELI3 polyclonal antibody raised against recombinant human PELI3.
• Dilution: Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: MGC35521
• Gene Symbols: PELI3
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human PELI3.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 246330
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG