PELP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB404824	Novus Biologicals NBP23256525UL	25 μL
NBP232565	Novus Biologicals NBP232565	0.1 mL

Description

PELP1 Polyclonal specifically detects PELP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PELP1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: HMX3, MNARmodulator of nongenomic activity of estrogen receptor, Modulator of non-genomic activity of estrogen receptor, P160, proline and glutamic acid rich nuclear protein, proline, glutamate and leucine rich protein 1, proline, glutamic acid and leucine rich protein 1, proline-, glutamic acid- and leucine-rich protein 1, proline-, glutamic acid-, leucine-rich protein 1, Transcription factor HMX3
• Gene Symbols: PELP1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cellular Markers, Transcription Factors and Regulators
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 27043
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only