PELP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258736

Catalog No. NBP258736

Description

PELP1 Polyclonal specifically detects PELP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PELP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: HMX3, MNARmodulator of nongenomic activity of estrogen receptor, Modulator of non-genomic activity of estrogen receptor, P160, proline and glutamic acid rich nuclear protein, proline, glutamate and leucine rich protein 1, proline, glutamic acid and leucine rich protein 1, proline-, glutamic acid- and leucine-rich protein 1, proline-, glutamic acid-, leucine-rich protein 1, Transcription factor HMX3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PELP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPPLACALQAFSLGQREDSLEVSSFCSEALVTCAALTHPRVPPLQPMGPTCPTPAPVPPPEAPSPFRAPPFHPPGPMPSVGSM
• Quantity: 100 μL
• Research Discipline: Cellular Markers, Transcription Factors and Regulators
• Gene ID (Entrez): 27043
• Target Species: Human
• Isotype: IgG

For Research Use Only