Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEPP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PEPP2 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PEPP2 Polyclonal specifically detects PEPP2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
PEPP2 | |
Polyclonal | |
Rabbit | |
Human | |
54477 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NSVKLNSLPSEYESGSACPAQTVHYRPINLSSSENKIVNVSLADLRGGNRPNTGPLYTEADRVIQRTNSMQQLEQWIKIQKGRGHEEETRGVI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
FLJ10667, FLJ26734, KIAA1686FLJ31492, PEPP-2, PEPP2phosphoinositol 3-phosphate-binding protein-2, PH domain-containing family A member 5, Phosphoinositol 3-phosphate-binding protein 2, pleckstrin homology domain containing, family A member 5, pleckstrin homology domain-containing family A member 5 | |
PLEKHA5 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title