Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pepsinogen I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25473025UL
Description
Pepsinogen I Polyclonal specifically detects Pepsinogen I in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Pepsinogen I | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
pepsinogen 3, group I (pepsinogen A) | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
643834 | |
Human | |
IgG |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PGA3 | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYI | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction