Learn More
Description
Specifications
Specifications
| Antigen | PER2 |
| Applications | ChIP Assay, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 2K9Y0 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Circadian clock protein PERIOD 2, FASPS, hPER2, KIAA0347period 2, period (Drosophila) homolog 2, period circadian protein 2, period circadian protein homolog 2, period homolog 2 (Drosophila) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PER2 (O15055). MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
