Periostin/OSF-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15915120UL

Catalog No. NB15931720

Description

Periostin/OSF-2 Polyclonal specifically detects Periostin/OSF-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Periostin/OSF-2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 5 ug/ml, Immunohistochemistry-Paraffin 5 ug/ml
• Gene Accession No.: Q15063
• Gene Symbols: POSTN
• Immunogen: Synthetic peptides corresponding to POSTN (periostin, osteoblast specific factor) The peptide sequence was selected from the N terminal of POSTN (NP_006466) and is located within the following region: RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10631
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: From PBS. with No Preservative
• Gene Alias: MGC119510, MGC119511, OSF-2osteoblast specific factor 2 (fasciclin I-like), OSF2periodontal ligament-specific periostin, Osteoblast-specific factor 2, PDLPOSTN, periostin, periostin isoform thy2, periostin isoform thy4, periostin isoform thy6, periostin isoform thy8, periostin, osteoblast specific factor, PNRP11-412K4.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 93 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG