Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Periostin/OSF-2 Antibody, Novus Biologicals™

Periostin/OSF-2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159151 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159151 100 μL
NB15931720 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159151 Supplier Novus Biologicals Supplier No. NBP159151
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Periostin/OSF-2 Polyclonal specifically detects Periostin/OSF-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Periostin/OSF-2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 5 ug/ml, Immunohistochemistry-Paraffin 5 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q15063
Gene Alias MGC119510, MGC119511, OSF-2osteoblast specific factor 2 (fasciclin I-like), OSF2periodontal ligament-specific periostin, Osteoblast-specific factor 2, PDLPOSTN, periostin, periostin isoform thy2, periostin isoform thy4, periostin isoform thy6, periostin isoform thy8, periostin, osteoblast specific factor, PNRP11-412K4.1
Gene Symbols POSTN
Host Species Rabbit
Immunogen Synthetic peptides corresponding to POSTN (periostin, osteoblast specific factor) The peptide sequence was selected from the N terminal of POSTN (NP_006466) and is located within the following region: RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL.
Molecular Weight of Antigen 93 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cardiovascular Biology, Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 10631
Test Specificity This antibody is pan specific for all splice variants of Periostin/OSF-2.
Reconstitution Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.