Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Periostin/OSF-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	Periostin/OSF-2
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB15931720 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15915120UL	20 μL	Each for $206.00	Only null left	Sign In or Register to check your price. Add to Cart

NBP159151 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159151	100 μL	Each for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

Periostin/OSF-2 Polyclonal specifically detects Periostin/OSF-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Periostin/OSF-2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q15063
Gene ID (Entrez)	10631
Immunogen	Synthetic peptides corresponding to POSTN (periostin, osteoblast specific factor) The peptide sequence was selected from the N terminal of POSTN (NP_006466) and is located within the following region: RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL.
Primary or Secondary	Primary

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	MGC119510, MGC119511, OSF-2osteoblast specific factor 2 (fasciclin I-like), OSF2periodontal ligament-specific periostin, Osteoblast-specific factor 2, PDLPOSTN, periostin, periostin isoform thy2, periostin isoform thy4, periostin isoform thy6, periostin isoform thy8, periostin, osteoblast specific factor, PNRP11-412K4.1
Gene Symbols	POSTN
Isotype	IgG
Molecular Weight of Antigen	93 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Periostin/OSF-2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents