Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Periostin/OSF-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$152.22 - $436.00
Specifications
| Antigen | Periostin/OSF-2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB15931720
|
Novus Biologicals
NBP15915120UL |
20 μL |
Each for $152.22
|
|
NBP159151
|
Novus Biologicals
NBP159151 |
100 μL |
Each for $436.00
|
|
Description
Periostin/OSF-2 Polyclonal specifically detects Periostin/OSF-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Periostin/OSF-2 | |
| Polyclonal | |
| Rabbit | |
| Q15063 | |
| 10631 | |
| Synthetic peptides corresponding to POSTN (periostin, osteoblast specific factor) The peptide sequence was selected from the N terminal of POSTN (NP_006466) and is located within the following region: RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| MGC119510, MGC119511, OSF-2osteoblast specific factor 2 (fasciclin I-like), OSF2periodontal ligament-specific periostin, Osteoblast-specific factor 2, PDLPOSTN, periostin, periostin isoform thy2, periostin isoform thy4, periostin isoform thy6, periostin isoform thy8, periostin, osteoblast specific factor, PNRP11-412K4.1 | |
| POSTN | |
| IgG | |
| Affinity Purified | |
| 93 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title