Peroxiredoxin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154337

Catalog No. NBP154337

Description

Peroxiredoxin 2 Polyclonal antibody specifically detects Peroxiredoxin 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: Peroxiredoxin 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.11.1, MGC4104, Natural killer cell-enhancing factor B, natural killer-enhancing factor B, NKEFBNKEF-B, peroxiredoxin 2, peroxiredoxin-2, PRPTDPX1, PRX2, PRXII, thiol-specific antioxidant 1, Thiol-specific antioxidant protein, Thioredoxin peroxidase 1, Thioredoxin-dependent peroxide reductase 1, torin, TPX1, TSAEC 1.11.1.15
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 7001
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P35704
• Gene Symbols: PRDX2
• Immunogen: Synthetic peptides corresponding to PRDX2(peroxiredoxin 2) The peptide sequence was selected from the middle region of PRDX2. Peptide sequence VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected to cross react based on sequence identity: Rabbit: 79%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Yeast, Zebrafish
• Isotype: IgG

For Research Use Only