Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Peroxiredoxin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Peroxiredoxin 3 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Peroxiredoxin 3 Polyclonal specifically detects Peroxiredoxin 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Peroxiredoxin 3 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Antioxidant protein 1MGC104387, AOP-1MGC24293, AOP1PRO1748, EC 1.11.1.15, HBC189, MER5, peroxiredoxin 3, Peroxiredoxin III, peroxiredoxin-3, Protein MER5 homolog, prx-III, SP-22, thioredoxin-dependent peroxide reductase, mitochondrial | |
PRDX3 | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P30048 | |
10935 | |
This antibody was developed against a recombinant protein corresponding to amino acids: VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title