Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Peroxiredoxin 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.31 - $649.28
Specifications
| Antigen | Peroxiredoxin 4 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Peroxiredoxin 4 Polyclonal antibody specifically detects Peroxiredoxin 4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Peroxiredoxin 4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 10549 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Antioxidant enzyme AOE372, AOE37-2PRX-4, EC 1.11.1.15, peroxiredoxin 4, Peroxiredoxin IV, peroxiredoxin-4, prx4, prx-4, Prx-IV, thioredoxin peroxidase (antioxidant enzyme), Thioredoxin peroxidase AO372, Thioredoxin-dependent peroxide reductase A0372 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title