Peroxiredoxin 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238370

Catalog No. NBP238370

Description

Peroxiredoxin 5 Polyclonal specifically detects Peroxiredoxin 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Peroxiredoxin 5
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P30044
• Gene Symbols: PRDX5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGN
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ACR1Peroxisomal antioxidant enzyme, Alu corepressor 1, Alu co-repressor 1, Antioxidant enzyme B166, AOEB166Peroxiredoxin V, B166, EC 1.11.1.15, Liver tissue 2D-page spot 71B, MGC117264, MGC142283, MGC142285, peroxiredoxin 5, peroxiredoxin-5, mitochondrial, PLPThioredoxin peroxidase PMP20, PMP20, PRDX6, prx-V, PRXV, SBBI10, Thioredoxin reductase, TPx type VI
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25824
• Target Species: Human
• Isotype: IgG