Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25849225UL
Description
PEX10 Polyclonal specifically detects PEX10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PEX10 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
NALD, peroxin 10, Peroxin-10, peroxisomal biogenesis factor 10MGC1998, Peroxisome assembly protein 10, RING finger protein 69, RNF69peroxisome biogenesis factor 10 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
PEX10 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYR | |
25 μL | |
Zinc Finger | |
5192 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction