Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255465
Description
PEX19 Polyclonal specifically detects PEX19 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
PEX19 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
D1S2223Ehousekeeping gene, 33kD, HK3333 kDa housekeeping protein, Peroxin-19, peroxisomal biogenesis factor 19, Peroxisomal farnesylated proteinFLJ55296, PMP1, PMPI, PXFperoxin-19, PXMP1 | |
Rabbit | |
Affinity Purified | |
RUO | |
5824 | |
Human | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PEX19 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQE | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction