Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PEX26 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	PEX26
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155115 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155115	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PEX26 Polyclonal specifically detects PEX26 in Human samples. It is validated for Western Blot.

Specifications

Antigen	PEX26
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q7Z412
Gene ID (Entrez)	55670
Immunogen	Synthetic peptides corresponding to PEX26(peroxisomal biogenesis factor 26) The peptide sequence was selected from the middle region of PEX26. Peptide sequence ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	FLJ20695, peroxin-26, peroxisomal biogenesis factor 26, peroxisome assembly protein 26, peroxisome biogenesis disorder, complementation group 8, peroxisome biogenesis disorder, complementation group A, peroxisome biogenesis factor 26, PEX26M1T, Pex26pM1T
Gene Symbols	PEX26
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PEX26 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents