Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PFKM Rabbit anti-Human, Rat, Polyclonal , Abnova™

Catalog No. 89934761 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-934-761 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-934-761 Supplier Abnova Corporation Supplier No. PAB29329
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against recombinant human PFKM.

The PFKM gene encodes the muscle isoform of phosphofructokinase (PFK) (ATP:D-fructose-6-phosphate-1-phosphotransferase, EC 2.7.1.11). PFK catalyzes the irreversible conversion of fructose-6-phosphate to fructose-1,6-bisphosphate and is a key regulatory enzyme in glycolysis. Mammalian PFK is a tetramer made up of various combinations of 3 subunits: muscle (PFKM), liver (PFKL; MIM 171860), and platelet (PFKP; MIM 171840), the genes for which are located on chromosomes 12q13, 21q22, and 10p, respectively. The composition of the tetramers differs according to the tissue type. Muscle and liver PFK are a homotetramers of 4M and 4L subunits, respectively. Erythrocytes contain both L and M subunits, which randomly tetramerize to form M4, L4, and M3L, M2L2, and ML3 hybrid forms of the holoenzyme (Vora et al., 1980 [PubMed 6444721]; Raben and Sherman, 1995 [PubMed 7550225]).[supplied by OMIM]

Sequence: CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA

Specifications

Antigen PFKM
Applications Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant human PFKM.
Dilution Immunohistochemistry (1:20-1:50) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene Alias GSD7/MGC8699/PFK-1/PFK-M/PFKX
Gene Symbols PFKM
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human PFKM.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5213
Target Species Human, Rat
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.