Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PGAM5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$682.00

Specifications

Antigen	PGAM5
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP192257 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP192257	0.1 mL	Each of 1 for $682.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PGAM5 Polyclonal specifically detects PGAM5 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen	PGAM5
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q96HS1
Gene ID (Entrez)	192111
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	Bcl-XL-binding protein v68, BXLBv68, EC 3.1.3.16, MGC5352, phosphoglycerate mutase family member 5BXLBV68, serine/threonine-protein phosphatase PGAM5, mitochondrial
Gene Symbols	PGAM5
Isotype	IgG
Purification Method	Affinity Purified
Molecular Weight of Antigen	32 kDa

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PGAM5 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents