Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGBD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PGBD3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PGBD3 Polyclonal specifically detects PGBD3 in Human samples. It is validated for Western Blot.Specifications
PGBD3 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ90201, piggyBac transposable element derived 3, piggyBac transposable element-derived protein 3 | |
PGBD3 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8N328 | |
267004 | |
Synthetic peptides corresponding to PGBD3(piggyBac transposable element derived 3) The peptide sequence was selected from the N terminal of PGBD3. Peptide sequence AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title