PGD2 Synthase/PTGDS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325049

Catalog No. NB301403

Description

PGD2 Synthase/PTGDS Polyclonal antibody specifically detects PGD2 Synthase/PTGDS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PGD2 Synthase/PTGDS
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Beta-trace protein, cerebrin-28, EC 5.3.99.2, Glutathione-independent PGD synthase, glutathione-independent PGD synthetase, lipocalin-type prostaglandin D synthase, Lipocalin-type prostaglandin-D synthase, L-PGDS, PDS, PGD2, PGD2 synthase, PGDS2, PGDSLPGDS, prostaglandin D synthase, prostaglandin D2 synthase (21kD, brain), prostaglandin D2 synthase 21kDa (brain), Prostaglandin-D2 synthase, prostaglandin-H2 D-isomerase
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PGD2 Synthase/PTGDS using the following amino acid sequence: PRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ
• Quantity: 100 μL
• Research Discipline: Mast Cell Markers, Neuroscience, Signal Transduction
• Gene ID (Entrez): 5730
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified