PGD2 Synthase/PTGDS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP179280

Catalog No. NBP179280

Description

PGD2 Synthase/PTGDS Polyclonal specifically detects PGD2 Synthase/PTGDS in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PGD2 Synthase/PTGDS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Beta-trace protein, cerebrin-28, EC 5.3.99.2, Glutathione-independent PGD synthase, glutathione-independent PGD synthetase, lipocalin-type prostaglandin D synthase, Lipocalin-type prostaglandin-D synthase, L-PGDS, PDS, PGD2, PGD2 synthase, PGDS2, PGDSLPGDS, prostaglandin D synthase, prostaglandin D2 synthase (21kD, brain), prostaglandin D2 synthase 21kDa (brain), Prostaglandin-D2 synthase, prostaglandin-H2 D-isomerase
• Host Species: Rabbit
• Molecular Weight of Antigen: 21 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rabbit: 80%, Guinea pig: 79%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P41222
• Gene Symbols: PTGDS
• Immunogen: Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5730
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only