Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGLYRP1/PGRP-S Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
Antigen | PGLYRP1/PGRP-S |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PGLYRP1/PGRP-S Polyclonal antibody specifically detects PGLYRP1/PGRP-S in Human samples. It is validated for ImmunofluorescenceSpecifications
PGLYRP1/PGRP-S | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Apoptosis | |
PBS, pH 7.2, 40% glycerol | |
8993 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
peptidoglycan recognition protein 1, Peptidoglycan recognition protein short, PGLYRP, PGRPpeptidoglycan recognition protein, PGRP-SMGC126894, PGRPSMGC126896, TAG7, TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein), TNFSF3L | |
This antibody was developed against Recombinant Protein corresponding to amino acids: VPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNF | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title