PGM1 Antibody (CL3301), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP259026

Catalog No. NBP259026

Description

PGM1 Monoclonal specifically detects PGM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PGM1
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: EC 5.4.2, EC 5.4.2.2, Glucose phosphomutase 1, GSD14, PGM 1, phosphoglucomutase 1, phosphoglucomutase-1
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PGM1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 5236
• Target Species: Human
• Form: Purified

For Research Use Only