Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $646.00
Specifications
| Antigen | PGR1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PGR1 Polyclonal specifically detects PGR1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PGR1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 15-oxoprostaglandin 13-reductase, EC 1.3.1.-, EC 1.3.1.48, EC 1.3.1.74, FLJ99229, leukotriene B4 12-hydroxydehydrogenase, LTB4DH, MGC34943, NADP-dependent leukotriene B4 12-hydroxydehydrogenase, PGR1, PRG-1, prostaglandin reductase 1, ZADH3, zinc binding alcohol dehydrogenase domain containing 3 | |
| PTGR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 22949 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title