Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGRMC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 13 publications
Supplier: Novus Biologicals NBP183220
Description
PGRMC1 Polyclonal specifically detects PGRMC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
PGRMC1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500-1:1000, KnockDown Validated | |
HPR6.6PGRMC, membrane-associated progesterone receptor component 1, MPR, progesterone binding protein, progesterone receptor membrane component 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human PGRMC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PGRMC1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR | |
0.1 mL | |
Cancer | |
10857 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction