Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGRMC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159827
Description
PGRMC1 Polyclonal specifically detects PGRMC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PGRMC1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
HPR6.6PGRMC, membrane-associated progesterone receptor component 1, MPR, progesterone binding protein, progesterone receptor membrane component 1 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Rat: 92%; Canine: 85%; Equine: 85%; Rabbit: 85%; Bovine: 78%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
O00264 | |
PGRMC1 | |
Synthetic peptides corresponding to PGRMC1(progesterone receptor membrane component 1) The peptide sequence was selected from the N terminal of PGRMC1. Peptide sequence MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ. | |
100 μL | |
Cancer | |
10857 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction