Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PHACTR3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP309933100UL

 View more versions of this product

Catalog No. NB124767


Add to cart

Description

Description

PHACTR3 Polyclonal specifically detects PHACTR3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PHACTR3
Unconjugated
PBS buffer, 2% sucrose
C20orf101, chromosome 20 open reading frame 101, H17739, MGC117178, phosphatase and actin regulator 3, scaffold-associated PP1 inhibiting protein, Scaffold-associated PP1-inhibiting protein, SCAPIN1, Scapinin
The immunogen for Anti-PHACTR3 antibody is: synthetic peptide directed towards the middle region of Human PHAR3. Peptide sequence SPHLTTVHRPLPPSRVIEELHRALATKHRQDSFQGRESKGSPKKRLDVRL
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
116154
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit