Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PHB Rabbit anti-Human, Mouse, Rat, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human PHB.

Manufacturer:  Abnova Corporation PAB29392

Catalog No. 89-934-764


Add to cart

Description

Description

Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed. It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor. Mutations in PHB have been linked to sporadic breast cancer. Prohibitin is expressed as two transcripts with varying lengths of 3' untranslated region. The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3' untranslated region may function as a trans-acting regulatory RNA. [provided by RefSeq]

Sequence: DVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLP
Specifications

Specifications

PHB
Unconjugated
Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/mL) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Liquid
PHB
Recombinant protein corresponding to human PHB.
Antigen affinity purification
RUO
Primary
5245
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant human PHB.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
PHB1
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human, Murine, Rat
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit