Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHF11 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PHF11 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180054
|
Novus Biologicals
NBP180054 |
100 μL |
Each for $436.00
|
|
NBP18005420
|
Novus Biologicals
NBP18005420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PHF11 Polyclonal specifically detects PHF11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PHF11 | |
Unconjugated | |
RUO | |
APY, BCAPIGHER, BRCA1 C-terminus-associated protein, IgE responsiveness (atopic), IGEL, IGER, NYREN34, NY-REN-34, NY-REN-34 antigen, PHD finger protein 11, Renal carcinoma antigen NY-REN-34 | |
PHF11 | |
IgG | |
Affinity Purified | |
37 kDa |
Polyclonal | |
Rabbit | |
NP_001035533 | |
51131 | |
Synthetic peptide directed towards the middle region of human PHF11. Peptide sequence FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title