Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHF11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PHF11 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
PHF11 Polyclonal specifically detects PHF11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PHF11 | |
Unconjugated | |
RUO | |
APY, BCAPIGHER, BRCA1 C-terminus-associated protein, IgE responsiveness (atopic), IGEL, IGER, NYREN34, NY-REN-34, NY-REN-34 antigen, PHD finger protein 11, Renal carcinoma antigen NY-REN-34 | |
PHF11 | |
IgG | |
37 kDa |
Polyclonal | |
Rabbit | |
NP_001035533 | |
51131 | |
Synthetic peptide directed towards the middle region of human PHF11. Peptide sequence FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title