Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHF11 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $378.35
Specifications
| Antigen | PHF11 |
|---|---|
| Immunogen | Synthetic peptide directed towards the middle region of human PHF11. Peptide sequence FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP18005420 |
Novus Biologicals
NBP18005420UL |
20ul |
Each for $152.22
|
|
NBP180054 |
Novus Biologicals
NBP180054 |
100 ul |
Each for $378.35
|
|
Description
PHF11 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Western Blotting.Specifications
| PHF11 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 51131 | |
| Affinity Purified | |
| Immunohistochemistry, Western Blot | |
| RUO |
| Synthetic peptide directed towards the middle region of human PHF11. Peptide sequence FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF. | |
| Primary | |
| IgG | |
| APY, BCAPIGHER, BRCA1 C-terminus-associated protein, IgE responsiveness (atopic), IGEL, IGER, NYREN34, NY-REN-34, NY-REN-34 antigen, PHD finger protein 11, Renal carcinoma antigen NY-REN-34 | |
| PBS & 2% Sucrose. with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title