Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHOSPHO1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | PHOSPHO1 |
---|---|
Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PHOSPHO1 Polyclonal antibody specifically detects PHOSPHO1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
PHOSPHO1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Protein Phosphatase | |
PBS (pH 7.2) and 40% Glycerol | |
162466 | |
IgG | |
Protein A purified |
Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 3.1.3.75, phosphatase, orphan 1, phosphoethanolamine/phosphocholine phosphatase | |
This antibody was developed against a recombinant protein corresponding to amino acids: RDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHSLFRRILSNPSGPDARGLLALRPF | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title