Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Phosphodiesterase 4A/PDE4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP233388
Description
Phosphodiesterase 4A/PDE4A Polyclonal specifically detects Phosphodiesterase 4A/PDE4A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Phosphodiesterase 4A/PDE4A | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
P27815 | |
PDE4A | |
This antibody was developed against a recombinant protein corresponding to amino acids: EAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHA | |
0.1 mL | |
Apoptosis, Signal Transduction, Stem Cell Markers | |
5141 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E2), phosphodiesterase E2 dunce homolog, Drosophila, phosphodiesterase isozyme 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction