Phospholipase C delta 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158918

Catalog No. NBP158918

Description

Phospholipase C delta 1 Polyclonal specifically detects Phospholipase C delta 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Phospholipase C delta 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1, EC 3.1.4.11, Phosphoinositide phospholipase C-delta-1, phospholipase C, delta 1, Phospholipase C-delta-1, Phospholipase C-III, PLC-delta-1, PLC-III
• Host Species: Rabbit
• Molecular Weight of Antigen: 86 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 5333
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P51178
• Gene Symbols: PLCD1
• Immunogen: Synthetic peptides corresponding to PLCD1(phospholipase C, delta 1) The peptide sequence was selected from the N terminal of PLCD1. Peptide sequence DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG