Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Phospholipid Scramblase 1/PLSCR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	Phospholipid Scramblase 1/PLSCR1
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15781620 View Documents View Product Certificates	Novus Biologicals NBP15781620UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP157816 View Documents View Product Certificates	Novus Biologicals NBP157816	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Phospholipid Scramblase 1/PLSCR1 Polyclonal specifically detects Phospholipid Scramblase 1/PLSCR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Phospholipid Scramblase 1/PLSCR1
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	O15162
Gene ID (Entrez)	5359
Immunogen	Synthetic peptides corresponding to PLSCR1(phospholipid scramblase 1) Antibody(against the N terminal of PLSCR1. Peptide sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP.
Primary or Secondary	Primary

Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	Erythrocyte phospholipid scramblase, MmTRA1b, MMTRA1BCa(2+)-dependent phospholipid scramblase 1, phospholipid scramblase 1, PL scramblase 1
Gene Symbols	PLSCR1
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Phospholipid Scramblase 1/PLSCR1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents