Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Phosphoribosyl Pyrophosphate Amidotransferase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP152964
Description
Phosphoribosyl Pyrophosphate Amidotransferase Polyclonal specifically detects Phosphoribosyl Pyrophosphate Amidotransferase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Phosphoribosyl Pyrophosphate Amidotransferase | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
ATASE, EC 2.4.2.14, glutamine phosphoribosylpyrophosphatate amidotransferase, Glutamine phosphoribosylpyrophosphate amidotransferase, glutamine PRPP amidotransferase, GPATamidophosphoribosyltransferase, phosphoribosyl pyrophosphate amidotransferase, PRAT | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Rabbit: 92%; Bovine: 85%; Canine: 85%; Equine: 85%; Xenopus: 78%. | |
Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q06203 | |
PPAT | |
Synthetic peptides corresponding to PPAT(phosphoribosyl pyrophosphate amidotransferase) The peptide sequence was selected from the N terminal of PPAT. Peptide sequence VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC. | |
100 μL | |
Lipid and Metabolism | |
5471 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction