Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Phosphoserine phosphatase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Phosphoserine phosphatase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Phosphoserine phosphatase Polyclonal specifically detects Phosphoserine phosphatase in Human samples. It is validated for Western Blot.Specifications
Phosphoserine phosphatase | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, phosphoserine phosphatase, PSPase, PSPEC 3.1.3.3 | |
PSPH | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
P78330 | |
5723 | |
Synthetic peptides corresponding to PSPH(phosphoserine phosphatase) The peptide sequence was selected from the middle region of PSPH. Peptide sequence IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title