PHOX2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25753625UL

Catalog No. NB403440

Description

PHOX2B Polyclonal specifically detects PHOX2B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PHOX2B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: NBPHOX, NBPhoxPhox2b, Neuroblastoma Phox, paired mesoderm homeobox 2b, paired mesoderm homeobox protein 2B, paired-like homeobox 2bNBLST2, PHOX2B homeodomain protein, PMX2Bneuroblastoma paired-type homeobox protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PHOX2B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 8929
• Target Species: Human, Rat
• Form: Purified

For Research Use Only