Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PHOX2B Antibody, Novus Biologicals™
SDP

Catalog No. NB403440 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403440 25 μL
NBP257536 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403440 Supplier Novus Biologicals Supplier No. NBP25753625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PHOX2B Polyclonal specifically detects PHOX2B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen PHOX2B
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias NBPHOX, NBPhoxPhox2b, Neuroblastoma Phox, paired mesoderm homeobox 2b, paired mesoderm homeobox protein 2B, paired-like homeobox 2bNBLST2, PHOX2B homeodomain protein, PMX2Bneuroblastoma paired-type homeobox protein
Gene Symbols PHOX2B
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 8929
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.