Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PI 3-Kinase C2 beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PI 3-Kinase C2 beta |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PI 3-Kinase C2 beta Polyclonal specifically detects PI 3-Kinase C2 beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PI 3-Kinase C2 beta | |
Polyclonal | |
Rabbit | |
Human | |
5287 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
C2-PI3KDKFZp686G16234, EC 2.7.1, EC 2.7.1.154, phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta, Phosphoinositide 3-kinase-C2-beta, phosphoinositide-3-kinase, class 2, beta polypeptide, PI3K-C2beta, PI3K-C2-beta, PTDINS-3-kinase C2 beta, PtdIns-3-kinase C2 subunit beta | |
PIK3C2B | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title