Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PI 3-Kinase p110 gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PI 3-Kinase p110 gamma |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PI 3-Kinase p110 gamma Polyclonal specifically detects PI 3-Kinase p110 gamma in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PI 3-Kinase p110 gamma | |
Polyclonal | |
Rabbit | |
mTOR Pathway, Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5294 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
1-phosphatidylinositol 3-kinase, EC 2.7.1, EC 2.7.1.153, p110-gamma, p120-PI3K, phosphatidylinositol 3 kinase gamma, p110 gamma, phosphatidylinositol 3-kinase catalytic 110-kD gamma, phosphatidylinositol 3-kinase, catalytic, gamma polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, phosphoinositide-3-kinase gamma catalytic subunit, phosphoinositide-3-kinase, catalytic, gamma polypeptide, PI3CG, PI3K, PI3Kgamma, PI3K-gamma, PI3-kinase subunit gamma, PIK3, PtdIns-3-kinase subunit gamma, PtdIns-3-kinase subunit p110-gamma | |
PIK3CG | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title