Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PI15, Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit Polyclonal Antibody

Manufacturer:  Abnova Corporation PAB31508

Catalog No. 89-998-491


Add to cart

Description

Description

Sequence: LLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDY
Specifications

Specifications

PI15
Unconjugated
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Liquid
PI15
Recombinant protein corresponding to human PI15.
100 μL
Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Primary
51050
Immunohistochemistry (Paraffin), Western Blot
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
peptidase inhibitor 15
CRISP8/DKFZp686F0366/P24TI/P25TI
Rabbit
IgG
RUO
Antibody
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit