Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIBF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PIBF1 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIBF1 Polyclonal specifically detects PIBF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
PIBF1 | |
Polyclonal | |
Rabbit | |
Human | |
C13orf24, chromosome 13 open reading frame 24, KIAA1008, PIBF, progesterone immunomodulatory binding factor 1, progesterone-induced blocking factor 1, progesterone-induced-blocking factor 1, RP11-505F3.1 | |
PIBF1 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
10464 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title