Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PIGC |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIGC Polyclonal specifically detects PIGC in Human samples. It is validated for Western Blot.Specifications
PIGC | |
Polyclonal | |
Rabbit | |
NP_002633 | |
5279 | |
Synthetic peptide directed towards the C terminal of human PIGCThe immunogen for this antibody is PIGC. Peptide sequence AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.4.1.198, GPI2class C protein, MGC2049, phosphatidylinositol glycan anchor biosynthesis, class C, phosphatidylinositol glycan, class C | |
PIGC | |
IgG | |
33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title