PIGP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB432710	Novus Biologicals NBP18429425UL	25 μL
NBP184294	Novus Biologicals NBP184294	0.1 mL

Description

PIGP Polyclonal specifically detects PIGP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PIGP
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51227
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: class P, DCRCDown syndrome critical region protein C, Down syndrome critical region protein 5, DSCR5DCRC-S, DSCRC, DSRC, EC 2.4.1.198, phosphatidylinositol glycan anchor biosynthesis, class P, Phosphatidylinositol-glycan biosynthesis class P protein, phosphatidylinositol-n-acetylglucosaminyltranferase subunit, PIG-P
• Gene Symbols: PIGP
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only