Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGQ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PIGQ |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIGQ Polyclonal specifically detects PIGQ in Human samples. It is validated for Western Blot.Specifications
PIGQ | |
Polyclonal | |
Rabbit | |
Q9BRB3 | |
9091 | |
Synthetic peptides corresponding to PIGQ(phosphatidylinositol glycan anchor biosynthesis, class Q) The peptide sequence was selected from the N terminal of PIGQ. Peptide sequence VLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
c407A10.1, c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)), class Q, EC 2.4.1.198, hGPI1, MGC12693, N-acetylglucosaminyl transferase component Gpi1, N-acetylglucosamyl transferase component GPI1, phosphatidylinositol glycan anchor biosynthesis, class Q, phosphatidylinositol N-acetylglucosaminyltransferase subunit Q, Phosphatidylinositol-glycan biosynthesis class Q protein, PIG-Q | |
PIGQ | |
IgG | |
84 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title