PIGZ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP232394

Catalog No. NBP232394

Description

PIGZ Polyclonal specifically detects PIGZ in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PIGZ
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: class Z, EC 2.4.1, EC 2.4.1.-, FLJ12768, GPI mannosyltransferase 4, GPI mannosyltransferase IV, GPI-MT-IV, hSMP3, phosphatidylinositol glycan anchor biosynthesis, class Z, Phosphatidylinositol-glycan biosynthesis class Z protein, PIG-Z, SMP3 mannosyltransferase, SMP3SMP3 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80235
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PIGZ
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DSWYFSSPATSRNLVLTPVNFLHYNLNPQNLARHGTHARLTHL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only