PIK3C2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB434055	Novus Biologicals NBP18090925UL	25ul
NBP180909	Novus Biologicals NBP180909	0.1 mL

Description

PIK3C2A Polyclonal specifically detects PIK3C2A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PIK3C2A
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: O00443
• Gene ID (Entrez): 5286
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C2-containing phosphatidylinositol kinase, CPK, DKFZp686L193, EC 2.7.1, EC 2.7.1.154, MGC142218, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha, Phosphoinositide 3-kinase-C2-alpha, phosphoinositide-3-kinase, class 2, alpha polypeptide, PI3-K-C2(ALPHA), PI3-K-C2A, PI3K-C2alpha, PI3K-C2-alpha, PtdIns-3-kinase C2 subunit alpha
• Gene Symbols: PIK3C2A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only