Invitrogen™ PIM1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595229

Catalog No. PIPA595229

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human K562 whole cell, human U20S whole cell, human Hela whole cell, human MCF-7 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The proto-oncogene PIM1 is upregulated in prostate cancer. PIM1, which belongs to the Serine/Threonine protein kinase family, is thought to play a role in signal transduction in blood cells. The protooncogene PIM1 encodes a protein kinase upregulated in prostate cancer. It may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. PIM1 is expressed primarily in cells of the hematopoietic and germ line lineages.

Specifications

• Antigen: PIM1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PIM1
• Gene Alias: non-specific serine/threonine protein kinase; Oncogene PIM1; PIM; Pim1; Pim-1; pim-1 kinase 44 kDa isoform; pim-1 oncogene; pim-1 oncogene (proviral integration site 1); Pim-1 proto-oncogene, serine/threonine kinase; proto-oncogene serine/threonine-protein kinase Pim-1; proviral integration site 1; serine/threonine-protein kinase pim-1; serine-threonine kinase PIM-1
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5292
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P11309
• Gene Symbols: PIM1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1 (373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov