Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595229

Invitrogen™ PIM1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595229
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595229 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595229 Supplier Invitrogen™ Supplier No. PA595229
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human K562 whole cell, human U20S whole cell, human Hela whole cell, human MCF-7 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The proto-oncogene PIM1 is upregulated in prostate cancer. PIM1, which belongs to the Serine/Threonine protein kinase family, is thought to play a role in signal transduction in blood cells. The protooncogene PIM1 encodes a protein kinase upregulated in prostate cancer. It may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. PIM1 is expressed primarily in cells of the hematopoietic and germ line lineages.
TRUSTED_SUSTAINABILITY

Specifications

Antigen PIM1
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene PIM1
Gene Accession No. P11309
Gene Alias non-specific serine/threonine protein kinase; Oncogene PIM1; PIM; Pim1; Pim-1; pim-1 kinase 44 kDa isoform; pim-1 oncogene; pim-1 oncogene (proviral integration site 1); Pim-1 proto-oncogene, serine/threonine kinase; proto-oncogene serine/threonine-protein kinase Pim-1; proviral integration site 1; serine/threonine-protein kinase pim-1; serine-threonine kinase PIM-1
Gene Symbols PIM1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1 (373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5292
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.